(data stored in ACNUC7421 zone)

EMBL: CP001630.PE312

CP001630.PE312       Location/Qualifiers
FT   CDS             346805..347281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0317"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: mex:Mext_1812 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase;
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropter
FT                   idinepyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34286"
FT                   /db_xref="GOA:C6WGH0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH0"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACU34286.1"
FT                   /translation="MSRAVLSLGSNLGDRLAHLRSAVDGFRPWLLAASPVYETAPWGVT
FT                   DQDDFLNAVLLVEGDLDEWGWLRRGQELERAAGRVRERRWGPRTLDVDVVAVDDVRSED
FT                   PELLLPHPGAHERATVLAPWLDVDPDAVLPGHGRVADLLSGVDLSGVRRLEVAL"
     MSRAVLSLGS NLGDRLAHLR SAVDGFRPWL LAASPVYETA PWGVTDQDDF LNAVLLVEGD        60
     LDEWGWLRRG QELERAAGRV RERRWGPRTL DVDVVAVDDV RSEDPELLLP HPGAHERATV       120
     LAPWLDVDPD AVLPGHGRVA DLLSGVDLSG VRRLEVAL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page