(data stored in ACNUC7421 zone)

EMBL: CP001630.PE313

CP001630.PE313       Location/Qualifiers
FT   CDS             347278..347730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2860 cytochrome c oxidase subunit
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34287"
FT                   /db_xref="GOA:C6WGH1"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34287.1"
FT                   /translation="MTFTKGRDLLAAGLGSAALVFLLLKLSYSGLPPLPRLAGLVLLVI
FT                   AAIDLGLAVSLRARILRKPGAEPVQPLTAARAVALAKASSVLGAIMAGAWGAVLLHVAP
FT                   ARGRFPAADNDLTSAVVGLVCAAALTASGLWLERCCRTPDEPERRA"
     MTFTKGRDLL AAGLGSAALV FLLLKLSYSG LPPLPRLAGL VLLVIAAIDL GLAVSLRARI        60
     LRKPGAEPVQ PLTAARAVAL AKASSVLGAI MAGAWGAVLL HVAPARGRFP AADNDLTSAV       120
     VGLVCAAALT ASGLWLERCC RTPDEPERRA                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page