(data stored in ACNUC7421 zone)

EMBL: CP001630.PE314

CP001630.PE314       Location/Qualifiers
FT   CDS             347781..349451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2162 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34288"
FT                   /db_xref="GOA:C6WGH2"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34288.1"
FT                   /translation="MTGRAPSRDDEQQEHGRGSARLLLVAALAFALVAAAVLVLSDNAR
FT                   WLRLAVVSALWAALVGAFLAARYRRQVADREDEVADLQNVYELELEREVAARREFELEL
FT                   ETEAHRKAQEDAKDDLDALRGELRALRENLEALLGGEVLVERVALRAEATRMRSLGDQS
FT                   RLDQSRLVSAMNEHRVITSGKAKKDDQPSVVDLDPAEQTELIERVTDAQPARRVEPVRR
FT                   EAARAEPVRRDPVRSGTRPPQPKSAAPAAPKQAVQPPGVKRAQPKAEPQRPAAQAKPAA
FT                   AQAAPTAQVAHPAKQQQPRPAEGTAQDYFTDQSARGGAAASRGQGEPVKTAESQRRSRI
FT                   AERTEMISRDSVAEERPARPAAGGLTASEQSGVRRSVAGGRPAAAEQGAQQARRPAAAT
FT                   GRTASEQSGVRRGVAGGRSASEQSGVRRPAAAAGRSASEQSAVRRPVAGGLSASEQAGG
FT                   VRRAVAGGRSASEQSTTRRPVADEATPHAPQPEQPEQAAGGRRRADPRDEAPQPAAGRR
FT                   AAPEPDPAAGAHADGKSVSELLAAFGGGDSPRRRRRRED"
     MTGRAPSRDD EQQEHGRGSA RLLLVAALAF ALVAAAVLVL SDNARWLRLA VVSALWAALV        60
     GAFLAARYRR QVADREDEVA DLQNVYELEL EREVAARREF ELELETEAHR KAQEDAKDDL       120
     DALRGELRAL RENLEALLGG EVLVERVALR AEATRMRSLG DQSRLDQSRL VSAMNEHRVI       180
     TSGKAKKDDQ PSVVDLDPAE QTELIERVTD AQPARRVEPV RREAARAEPV RRDPVRSGTR       240
     PPQPKSAAPA APKQAVQPPG VKRAQPKAEP QRPAAQAKPA AAQAAPTAQV AHPAKQQQPR       300
     PAEGTAQDYF TDQSARGGAA ASRGQGEPVK TAESQRRSRI AERTEMISRD SVAEERPARP       360
     AAGGLTASEQ SGVRRSVAGG RPAAAEQGAQ QARRPAAATG RTASEQSGVR RGVAGGRSAS       420
     EQSGVRRPAA AAGRSASEQS AVRRPVAGGL SASEQAGGVR RAVAGGRSAS EQSTTRRPVA       480
     DEATPHAPQP EQPEQAAGGR RRADPRDEAP QPAAGRRAAP EPDPAAGAHA DGKSVSELLA       540
     AFGGGDSPRR RRRRED                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page