(data stored in ACNUC7421 zone)

EMBL: CP001630.PE315

CP001630.PE315       Location/Qualifiers
FT   CDS             complement(349936..351012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0320"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: bcz:BCZK4997 NADH dehydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34289"
FT                   /db_xref="GOA:C6WGH3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH3"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACU34289.1"
FT                   /translation="MQITVGVGAGAKHLGVDRVVDLGPLHPSAHGAYRLRLTVRDDEVI
FT                   TSAEPLVGHLHRGAEKLFEVRDYRQVLTLANRHDWLAAFCNELAVALAVERMTGMDVPP
FT                   RAQWLRALLCELNRVMAHLVFLAPLTDPVAAARGREAVQAVLEEASGGRIHFMANRIGG
FT                   LREDVPAGWAERVAGALDAVEVPEVPTGLAGLGVLSRADALARGVTGPIGRASGVDLDL
FT                   RRDDPLPAYRELDVRPSVRDGGDAHARVACMVDDLAQAVALARECLRRLPGGPVNLRLP
FT                   KAVKAPEGSVYTRVEAPLGVSGVHLASRGEKTPWRLKLRTPSFNNVQALSALLPGTPVA
FT                   QLPLVLGSFAVVVGDIDR"
     MQITVGVGAG AKHLGVDRVV DLGPLHPSAH GAYRLRLTVR DDEVITSAEP LVGHLHRGAE        60
     KLFEVRDYRQ VLTLANRHDW LAAFCNELAV ALAVERMTGM DVPPRAQWLR ALLCELNRVM       120
     AHLVFLAPLT DPVAAARGRE AVQAVLEEAS GGRIHFMANR IGGLREDVPA GWAERVAGAL       180
     DAVEVPEVPT GLAGLGVLSR ADALARGVTG PIGRASGVDL DLRRDDPLPA YRELDVRPSV       240
     RDGGDAHARV ACMVDDLAQA VALARECLRR LPGGPVNLRL PKAVKAPEGS VYTRVEAPLG       300
     VSGVHLASRG EKTPWRLKLR TPSFNNVQAL SALLPGTPVA QLPLVLGSFA VVVGDIDR         358
//

If you have problems or comments...

PBIL Back to PBIL home page