(data stored in ACNUC7421 zone)

EMBL: CP001630.PE317

CP001630.PE317       Location/Qualifiers
FT   CDS             351540..352457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0322"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   lch:Lcho_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34291"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH5"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ACU34291.1"
FT                   /translation="MQDVESAWRTALYGPSGFFTRGEAPSDHFRTAPLVGPELAEALLE
FT                   LLRRVDTALDRPDALDLVDLGAGGGELSAAVRALADADPALRDRLRVTAVDVGPTRDLP
FT                   GVRWTRDLPDRVTGLLVAHEWLDALPCPVVAWPHRDPWLDRWWPLRPGGRAEIGAPRDA
FT                   AWASAVARVRGAALAIDYGHLADDRAAGRYPRGTFTAYRSGNQVAPVFDGSCDLTAHVA
FT                   LDACAEAAGRPWTLVSQRDALAALGLPAEPLTARTPDWLTAAARASRIAELRDPHGLGA
FT                   FGWLLHPRGTTTADLLPDLPPWRP"
     MQDVESAWRT ALYGPSGFFT RGEAPSDHFR TAPLVGPELA EALLELLRRV DTALDRPDAL        60
     DLVDLGAGGG ELSAAVRALA DADPALRDRL RVTAVDVGPT RDLPGVRWTR DLPDRVTGLL       120
     VAHEWLDALP CPVVAWPHRD PWLDRWWPLR PGGRAEIGAP RDAAWASAVA RVRGAALAID       180
     YGHLADDRAA GRYPRGTFTA YRSGNQVAPV FDGSCDLTAH VALDACAEAA GRPWTLVSQR       240
     DALAALGLPA EPLTARTPDW LTAAARASRI AELRDPHGLG AFGWLLHPRG TTTADLLPDL       300
     PPWRP                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page