(data stored in ACNUC7421 zone)

EMBL: CP001630.PE318

CP001630.PE318       Location/Qualifiers
FT   CDS             352527..353855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0323"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: scl:sce5075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34292"
FT                   /db_xref="GOA:C6WGH6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH6"
FT                   /inference="protein motif:COG:COG2339"
FT                   /protein_id="ACU34292.1"
FT                   /translation="MTAAAPSPARKRTEQRRWTVLLPVAALIVLGVCGLVLLGLGTSKV
FT                   GLAPILVGAAASLLPVMAVLSAYLWLDRWEPEPAKILLFGFAWGACGATITSLVFNQTA
FT                   QVIGELINDGDGATFAAVVGAPIVEEATKGVFLIALFLRRRHEFDGAVDGLVYAGVVAA
FT                   GFAFTENIYYFARVFVDSGLGDASSGVVALFILRGVLSPFAHPLFTSMLGIGVGLAAMS
FT                   HKRGVRIAGPLLGYLGAVGLHSLWNFSTTVGTGSTFINLYFLIMVPIFAGMVWLVVWQR
FT                   RREQRIVAEQLPGMAERQWIAASEVTLLASLQGRSRWRRTVRRKAGDGAAKAVAGYQVA
FT                   ATELAFLRHRMALGTAGADADRRHANLLRSLLATRVAAVNAPGALGAADGAGRPRLTER
FT                   AERTVRIARIARQGRAARPDAQGRPGSPTSPNDPDATGGVRRS"
     MTAAAPSPAR KRTEQRRWTV LLPVAALIVL GVCGLVLLGL GTSKVGLAPI LVGAAASLLP        60
     VMAVLSAYLW LDRWEPEPAK ILLFGFAWGA CGATITSLVF NQTAQVIGEL INDGDGATFA       120
     AVVGAPIVEE ATKGVFLIAL FLRRRHEFDG AVDGLVYAGV VAAGFAFTEN IYYFARVFVD       180
     SGLGDASSGV VALFILRGVL SPFAHPLFTS MLGIGVGLAA MSHKRGVRIA GPLLGYLGAV       240
     GLHSLWNFST TVGTGSTFIN LYFLIMVPIF AGMVWLVVWQ RRREQRIVAE QLPGMAERQW       300
     IAASEVTLLA SLQGRSRWRR TVRRKAGDGA AKAVAGYQVA ATELAFLRHR MALGTAGADA       360
     DRRHANLLRS LLATRVAAVN APGALGAADG AGRPRLTERA ERTVRIARIA RQGRAARPDA       420
     QGRPGSPTSP NDPDATGGVR RS                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page