(data stored in ACNUC7421 zone)

EMBL: CP001630.PE319

CP001630.PE319       Location/Qualifiers
FT   CDS             353944..354837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0324"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_02774 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34293"
FT                   /db_xref="GOA:C6WGH7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH7"
FT                   /inference="similar to AA sequence:KEGG:SYN_02774"
FT                   /protein_id="ACU34293.1"
FT                   /translation="MDATPRPARLAAGVISAGRVGSVLGAALTRAGHAVSAVSAVGAAS
FT                   LRRADALLPDVPVLPPPDVAAGADLVLLAVPDDELPGLVRGLVATGSLRAGQIVVHVSG
FT                   AQGVAALAPAAEVGALCLALHPAMTFTGRPEDVDRVRACTFGVTAADGDDIAWSVGEAL
FT                   VVEIGAEAVRVPESARPLYHAALTHGANHLMTLVADCAEALRGAGVANPERVLAPLLGA
FT                   ALDNALRHGDRALTGPVARGDTGTVAKHLAVLADRAPGTLDAYRALARRTADRAESAGL
FT                   LPADRATDVRTTLDED"
     MDATPRPARL AAGVISAGRV GSVLGAALTR AGHAVSAVSA VGAASLRRAD ALLPDVPVLP        60
     PPDVAAGADL VLLAVPDDEL PGLVRGLVAT GSLRAGQIVV HVSGAQGVAA LAPAAEVGAL       120
     CLALHPAMTF TGRPEDVDRV RACTFGVTAA DGDDIAWSVG EALVVEIGAE AVRVPESARP       180
     LYHAALTHGA NHLMTLVADC AEALRGAGVA NPERVLAPLL GAALDNALRH GDRALTGPVA       240
     RGDTGTVAKH LAVLADRAPG TLDAYRALAR RTADRAESAG LLPADRATDV RTTLDED          297
//

If you have problems or comments...

PBIL Back to PBIL home page