(data stored in ACNUC7421 zone)

EMBL: CP001630.PE32

CP001630.PE32        Location/Qualifiers
FT   CDS             complement(35861..36493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0032"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce5559
FT                   HTH-type transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34006"
FT                   /db_xref="GOA:C6WCI5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34006.1"
FT                   /translation="MTSTTPLRRQPVQQRSAKRVERMLEACAALIEEVGYDGVTTTLIA
FT                   ERAGVAVGSLYQFFPDKRAVVQELTLRNLERFIQTVDGTFTTKALAHWWDAVDSIFDVY
FT                   VAMHREVPAFSRLHFGDVVDLRLMDDRKDNNSVVSDRIAEMISSRFAIPLDEVKLPISI
FT                   AVEAADGVLGLAFRRDPAGDPLVLDEAKAMIRGYLSTRMPGQPPATP"
     MTSTTPLRRQ PVQQRSAKRV ERMLEACAAL IEEVGYDGVT TTLIAERAGV AVGSLYQFFP        60
     DKRAVVQELT LRNLERFIQT VDGTFTTKAL AHWWDAVDSI FDVYVAMHRE VPAFSRLHFG       120
     DVVDLRLMDD RKDNNSVVSD RIAEMISSRF AIPLDEVKLP ISIAVEAADG VLGLAFRRDP       180
     AGDPLVLDEA KAMIRGYLST RMPGQPPATP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page