(data stored in ACNUC7421 zone)

EMBL: CP001630.PE320

CP001630.PE320       Location/Qualifiers
FT   CDS             354841..355731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0325"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: mno:Mnod_1014 pantoate/beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34294"
FT                   /db_xref="GOA:C6WGH8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACU34294.1"
FT                   /translation="MTKPLTKDDYTPGGVTVHRDPERLRRVTRALRSAGRNIALVPTMG
FT                   ALHEGHRRLIREAHVLQNTVVVVSVFVNPTQFGEAADLERYPRDLDADVEVCRQERAPL
FT                   VFAPEVATMYPAGSQVTLDPGPLGSELEGASRPGHFAGVLTVVSKLFNVVQPDYALFGE
FT                   KDYQQLSLIGRMATDLNVPTAVVGVPTVRESDGLALSSRNRFLSESERESATALSAALV
FT                   AGSHVSALGAEAVLSTARATLDAVPGLDLDYLELRAPDLGPAPVNGDARLLVAARVGST
FT                   RLIDNVPVLLGAGDE"
     MTKPLTKDDY TPGGVTVHRD PERLRRVTRA LRSAGRNIAL VPTMGALHEG HRRLIREAHV        60
     LQNTVVVVSV FVNPTQFGEA ADLERYPRDL DADVEVCRQE RAPLVFAPEV ATMYPAGSQV       120
     TLDPGPLGSE LEGASRPGHF AGVLTVVSKL FNVVQPDYAL FGEKDYQQLS LIGRMATDLN       180
     VPTAVVGVPT VRESDGLALS SRNRFLSESE RESATALSAA LVAGSHVSAL GAEAVLSTAR       240
     ATLDAVPGLD LDYLELRAPD LGPAPVNGDA RLLVAARVGS TRLIDNVPVL LGAGDE           296
//

If you have problems or comments...

PBIL Back to PBIL home page