(data stored in ACNUC7421 zone)

EMBL: CP001630.PE321

CP001630.PE321       Location/Qualifiers
FT   CDS             355746..356216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0326"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: bcb:BCB4264_A1597 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34295"
FT                   /db_xref="GOA:C6WGH9"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH9"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACU34295.1"
FT                   /translation="MFRTMLKSKIHRATVTQADLHYVGSVTVDEDLMDAADLLAGEQVA
FT                   IVDVTNGARLETYVIPGERGSGVIGINGAAAHLVHPGDLVILIAYGSMDDAEARAYRPR
FT                   VVFVDADNKVVELGSDAARAPEGSGLLSGAVTAQALAETADAAALDALIQNQ"
     MFRTMLKSKI HRATVTQADL HYVGSVTVDE DLMDAADLLA GEQVAIVDVT NGARLETYVI        60
     PGERGSGVIG INGAAAHLVH PGDLVILIAY GSMDDAEARA YRPRVVFVDA DNKVVELGSD       120
     AARAPEGSGL LSGAVTAQAL AETADAAALD ALIQNQ                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page