(data stored in ACNUC7421 zone)

EMBL: CP001630.PE322

CP001630.PE322       Location/Qualifiers
FT   CDS             356227..357012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0327"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: ank:AnaeK_1477 putative
FT                   transcriptional acitvator, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34296"
FT                   /db_xref="GOA:C6WGI0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI0"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACU34296.1"
FT                   /translation="MLLVIDVGNTNIVLGLYDGTGDSAALVHSWRMRTDARMTADELAL
FT                   TMRGLLGEYADKITGISALSTVPAVLRELRVMLGRYYASVPKVLVEPGVRTGVPLLVDN
FT                   PKEVGSDRVINTMAAHHLHSTACVVVDFGTSTNLDVISAKGEFLGGALAPGIEISVDAL
FT                   AARAAQLHKVELVRPRSVIGKNTVECLQSGIVYGFVGQVDGLVRRIVEELATVDPGPVT
FT                   VLATGGLAPLVVSESTAIQIHAPDLTLLGLRLVFERNMR"
     MLLVIDVGNT NIVLGLYDGT GDSAALVHSW RMRTDARMTA DELALTMRGL LGEYADKITG        60
     ISALSTVPAV LRELRVMLGR YYASVPKVLV EPGVRTGVPL LVDNPKEVGS DRVINTMAAH       120
     HLHSTACVVV DFGTSTNLDV ISAKGEFLGG ALAPGIEISV DALAARAAQL HKVELVRPRS       180
     VIGKNTVECL QSGIVYGFVG QVDGLVRRIV EELATVDPGP VTVLATGGLA PLVVSESTAI       240
     QIHAPDLTLL GLRLVFERNM R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page