(data stored in ACNUC7421 zone)

EMBL: CP001630.PE323

CP001630.PE323       Location/Qualifiers
FT   CDS             complement(357087..357866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0328"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mno:Mnod_8065 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34297"
FT                   /db_xref="GOA:C6WGI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34297.1"
FT                   /translation="MTSAEDHADLWARRAASFGAQASAYAEHRPDYPAEAIKWCLDPLE
FT                   STPLRVLDLAAGTGKLTAGVVALGHHVTAVEPDEQMLSELVRRNGGVRALPGTAERIPV
FT                   PGGTVDAVVVGQAFHWFDQTRALAEIARVLRPGGVLAALWTGDDHTVPWVADYLSAVWG
FT                   VDGDPHKIGSSGGPAEIMPQHEMFHDQETARFAHRQRRTPETLVATLRTHSGVATLPEA
FT                   ERLALEAKALDFLRSREETRDGFDLPLRVMVKRMVRV"
     MTSAEDHADL WARRAASFGA QASAYAEHRP DYPAEAIKWC LDPLESTPLR VLDLAAGTGK        60
     LTAGVVALGH HVTAVEPDEQ MLSELVRRNG GVRALPGTAE RIPVPGGTVD AVVVGQAFHW       120
     FDQTRALAEI ARVLRPGGVL AALWTGDDHT VPWVADYLSA VWGVDGDPHK IGSSGGPAEI       180
     MPQHEMFHDQ ETARFAHRQR RTPETLVATL RTHSGVATLP EAERLALEAK ALDFLRSREE       240
     TRDGFDLPLR VMVKRMVRV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page