(data stored in ACNUC7421 zone)

EMBL: CP001630.PE324

CP001630.PE324       Location/Qualifiers
FT   CDS             357929..359440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0329"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: dal:Dalk_1784 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34298"
FT                   /db_xref="GOA:C6WGI2"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI2"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACU34298.1"
FT                   /translation="MSEQPQTGSPTSDDDLPEQLRVRREKRARLLERGVDPYPVEVART
FT                   HSLREVREAHTGLDPDTGTGEVVGVTGRVMFIRNTGKLAFATLREGDGTELQAMLSLNK
FT                   VGEQALADWKSDVDLGDHVFVRGEVITSRRGELSVMADEWAITAKALRPLPVAHKELAE
FT                   ETRIRQRYVDLILREQARDTVRNRAKLVRSLRESFHRRGFTEVETPMLQTLQGGAAARP
FT                   FVTRSNALDIDLFLRIAPELYLKRCVVGGIEKVFEINRNFRNEGIDSSHSPEFSMLEYY
FT                   EAYATYDTNAVMTRELIQEAAMAVAGSHVVTLVDGTEYDLGGEWTTLTMYGSLSEAAGV
FT                   EVTPGTSVDDLRALADKLGLETDPKLGHGKLVEELWEHLVGDHLHAPTFVRDFPVETSP
FT                   LTRQHRSTPGVAEKWDLYVRGFELATGYSELVDPVVERERLEAQARLGASGDVEAMPVD
FT                   EDFLRSLEYGMPPSGGVGMGIDRLLMAITGLGIRETILFPLVRPE"
     MSEQPQTGSP TSDDDLPEQL RVRREKRARL LERGVDPYPV EVARTHSLRE VREAHTGLDP        60
     DTGTGEVVGV TGRVMFIRNT GKLAFATLRE GDGTELQAML SLNKVGEQAL ADWKSDVDLG       120
     DHVFVRGEVI TSRRGELSVM ADEWAITAKA LRPLPVAHKE LAEETRIRQR YVDLILREQA       180
     RDTVRNRAKL VRSLRESFHR RGFTEVETPM LQTLQGGAAA RPFVTRSNAL DIDLFLRIAP       240
     ELYLKRCVVG GIEKVFEINR NFRNEGIDSS HSPEFSMLEY YEAYATYDTN AVMTRELIQE       300
     AAMAVAGSHV VTLVDGTEYD LGGEWTTLTM YGSLSEAAGV EVTPGTSVDD LRALADKLGL       360
     ETDPKLGHGK LVEELWEHLV GDHLHAPTFV RDFPVETSPL TRQHRSTPGV AEKWDLYVRG       420
     FELATGYSEL VDPVVERERL EAQARLGASG DVEAMPVDED FLRSLEYGMP PSGGVGMGID       480
     RLLMAITGLG IRETILFPLV RPE                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page