(data stored in ACNUC7421 zone)

EMBL: CP001630.PE325

CP001630.PE325       Location/Qualifiers
FT   CDS             359559..359909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34299"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34299.1"
FT                   /translation="MAQKVTVTLVDDLDGGVAEETVDFGLDGVAYQIDLSSVNAGKLRS
FT                   ALGAFTTAARKTGGRKRGPGRPAGVKAAARPASADREQNQAIREWARKQGMKVSDRGRI
FT                   PAEVLEAYHQQG"
     MAQKVTVTLV DDLDGGVAEE TVDFGLDGVA YQIDLSSVNA GKLRSALGAF TTAARKTGGR        60
     KRGPGRPAGV KAAARPASAD REQNQAIREW ARKQGMKVSD RGRIPAEVLE AYHQQG           116
//

If you have problems or comments...

PBIL Back to PBIL home page