(data stored in ACNUC7421 zone)

EMBL: CP001630.PE326

CP001630.PE326       Location/Qualifiers
FT   CDS             360226..361230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0331"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pde:Pden_3523 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34300"
FT                   /db_xref="GOA:C6WGI4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34300.1"
FT                   /translation="MVTVRTTRRYGVLALLLGALALAAAASVAFGSKSIDLGSVAHALL
FT                   SPTGTEDDSIVRELRLPRTGFAIAVGMALGIGGALIQGHTRNPLADPGILGINQGAGFA
FT                   VVLAISLLGVTSPLGYVWFAFAGALAASVVVFLLGSGRNGPTPVTLALAGAAVSALLQG
FT                   LISGVVLSDRQSLDSFRFWQVGSVEGRDVEVLWQVLPFLVVGLVLAAFNAPGLNALSLG
FT                   DEVARSLGQNVNRTRALGIGAITLLVGGSVAACGPIGFLGLVVPHAARAVTGPDHRWLL
FT                   PVAGLMGGVLLLVADVLGRVVARPGELEVGIVMALVGAPFFVALVRRRNLVKL"
     MVTVRTTRRY GVLALLLGAL ALAAAASVAF GSKSIDLGSV AHALLSPTGT EDDSIVRELR        60
     LPRTGFAIAV GMALGIGGAL IQGHTRNPLA DPGILGINQG AGFAVVLAIS LLGVTSPLGY       120
     VWFAFAGALA ASVVVFLLGS GRNGPTPVTL ALAGAAVSAL LQGLISGVVL SDRQSLDSFR       180
     FWQVGSVEGR DVEVLWQVLP FLVVGLVLAA FNAPGLNALS LGDEVARSLG QNVNRTRALG       240
     IGAITLLVGG SVAACGPIGF LGLVVPHAAR AVTGPDHRWL LPVAGLMGGV LLLVADVLGR       300
     VVARPGELEV GIVMALVGAP FFVALVRRRN LVKL                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page