(data stored in ACNUC7421 zone)

EMBL: CP001630.PE327

CP001630.PE327       Location/Qualifiers
FT   CDS             361227..362411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0332"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ppg:PputGB1_1806 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34301"
FT                   /db_xref="GOA:C6WGI5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI5"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34301.1"
FT                   /translation="MSGDGGAAGEGTAAHGATATGATAVGLASGVPVGGDALARPTVKG
FT                   RTGVRLGPLSWPLRWRPIALVLGGLALAATVLAVAIAYGDFPISLGQVVDVLLGGGSRS
FT                   QRFVVMELRLPRVLTGLLVGAALAASGAIFQAISRNPLATPDIIGVTWGAGTGAVLVIV
FT                   LAGSSGAAAGAVAQVGVPLAALAGGLIAGLVVYGIAWRRGIEGFRLVLVGVGVTAITAN
FT                   ATQYLLTKADVNDTARAMVWIAGSLNNRGWEHIVPVALALVVLLPASVLATRTLGALQF
FT                   GDDTTRGLGVRLNGARTALLLLGVVLAAVATAAAGPVGFVALAAPQIAVRLAGTATPPL
FT                   FGSAVVGAVLVVLSDLIARQLIDGTELPVGVVTAVLGAPYLMHLLIRSRREART"
     MSGDGGAAGE GTAAHGATAT GATAVGLASG VPVGGDALAR PTVKGRTGVR LGPLSWPLRW        60
     RPIALVLGGL ALAATVLAVA IAYGDFPISL GQVVDVLLGG GSRSQRFVVM ELRLPRVLTG       120
     LLVGAALAAS GAIFQAISRN PLATPDIIGV TWGAGTGAVL VIVLAGSSGA AAGAVAQVGV       180
     PLAALAGGLI AGLVVYGIAW RRGIEGFRLV LVGVGVTAIT ANATQYLLTK ADVNDTARAM       240
     VWIAGSLNNR GWEHIVPVAL ALVVLLPASV LATRTLGALQ FGDDTTRGLG VRLNGARTAL       300
     LLLGVVLAAV ATAAAGPVGF VALAAPQIAV RLAGTATPPL FGSAVVGAVL VVLSDLIARQ       360
     LIDGTELPVG VVTAVLGAPY LMHLLIRSRR EART                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page