(data stored in ACNUC7421 zone)

EMBL: CP001630.PE328

CP001630.PE328       Location/Qualifiers
FT   CDS             362408..363256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0333"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cvi:CV_2234 enterobactin-iron transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34302"
FT                   /db_xref="GOA:C6WGI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34302.1"
FT                   /translation="MTTAPPSPSARLRAHELSIGYGDRVIVDRLDLDVLDGAVTAVIGP
FT                   NGCGKSTMLRALARLLPTRGGQVLLDGRPITEVPTREVAKVLGMLPQTPQGPEGLTVAD
FT                   LVARGRHPHQAWYRQWSGDDEAAVAEALRLTGMEDFAERTLDQLSGGQRQRAWISMALA
FT                   QGTDLLLLDEPTTYLDLAHQIDVLDLVRLLHAEGGRTIVMVLHDLNLAARYADHLVAMK
FT                   DGRIVVQGAPSEVLTEQVLKEVFGLEAAVIEDPVAGTPMVVPIRSTTHAAANRRKDHPK
FT                   G"
     MTTAPPSPSA RLRAHELSIG YGDRVIVDRL DLDVLDGAVT AVIGPNGCGK STMLRALARL        60
     LPTRGGQVLL DGRPITEVPT REVAKVLGML PQTPQGPEGL TVADLVARGR HPHQAWYRQW       120
     SGDDEAAVAE ALRLTGMEDF AERTLDQLSG GQRQRAWISM ALAQGTDLLL LDEPTTYLDL       180
     AHQIDVLDLV RLLHAEGGRT IVMVLHDLNL AARYADHLVA MKDGRIVVQG APSEVLTEQV       240
     LKEVFGLEAA VIEDPVAGTP MVVPIRSTTH AAANRRKDHP KG                          282
//

If you have problems or comments...

PBIL Back to PBIL home page