(data stored in ACNUC7421 zone)

EMBL: CP001630.PE329

CP001630.PE329       Location/Qualifiers
FT   CDS             complement(363284..364099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34303"
FT                   /db_xref="GOA:C6WGI7"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34303.1"
FT                   /translation="MTVPARIDPRDALNPLADTVSATSSLVGWLEIRYERTGGGAPDGW
FT                   TRCSDLLADPGRFTAWRGELADWLEGQHGGSTERATAGYVLGWYLGAVGMLGGALFHRA
FT                   RRVPSLRPEDLALRLADDGRPDVVGVALLAGGFACLPSDPAGNHPEATVVADESALAAL
FT                   LRARFAGHAAAFAAAYGPTTRLGRRALWAAATDALDGSAWLAGLHGGDEAAGVADSALL
FT                   LPFPEAPYTSATTLRVVDGTWTRRRESCCFHFTLPGAQACDTCPRVCGK"
     MTVPARIDPR DALNPLADTV SATSSLVGWL EIRYERTGGG APDGWTRCSD LLADPGRFTA        60
     WRGELADWLE GQHGGSTERA TAGYVLGWYL GAVGMLGGAL FHRARRVPSL RPEDLALRLA       120
     DDGRPDVVGV ALLAGGFACL PSDPAGNHPE ATVVADESAL AALLRARFAG HAAAFAAAYG       180
     PTTRLGRRAL WAAATDALDG SAWLAGLHGG DEAAGVADSA LLLPFPEAPY TSATTLRVVD       240
     GTWTRRRESC CFHFTLPGAQ ACDTCPRVCG K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page