(data stored in ACNUC7421 zone)

EMBL: CP001630.PE33

CP001630.PE33        Location/Qualifiers
FT   CDS             36613..37875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0033"
FT                   /product="beta-galactosidase"
FT                   /note="TIGRFAM: beta-galactosidase; PFAM: glycoside
FT                   hydrolase family 1; KEGG: hch:HCH_06907
FT                   beta-glucosidase/6-phospho-beta-
FT                   glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34007"
FT                   /db_xref="GOA:C6WCI6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI6"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ACU34007.1"
FT                   /translation="MTGPDFLWGVSTSAFQIEGGFDEDGRLPSVWDEFPSFEGQTARVA
FT                   CDHRNRHAEDVALLRELGVNAYRFSLSWPRVEGGRAAGSGSAASSGLDFYDRLVDDLLD
FT                   AGIAPVATLYHWDTPAHVEEAGGWLARDTAHRLADYAATAAARLADRVAMWIPVNEPAI
FT                   VTLLGYATGQHAPGKALLFDALPAAHHLNLGHGLAVQALRAAGATSVGTANNHTPAWAA
FT                   TGSAEDAAAASAYADLHNWLYADPVLAGRYPESLVDLLPVEDGDLATIAQPLDFYGVNY
FT                   YNPTRLSAPSPGNPLPFDLVPITEHPVTGFGWPVVPAGLGEMIGALRTRHPNLPPVHVT
FT                   ESGCSYPHSLDDTERVDYLAAHSEAAIAAGAKGYFVWSVLDNFEWDSGYSQRFGLVHVD
FT                   YATQRRTPRASFRWYRDRIRR"
     MTGPDFLWGV STSAFQIEGG FDEDGRLPSV WDEFPSFEGQ TARVACDHRN RHAEDVALLR        60
     ELGVNAYRFS LSWPRVEGGR AAGSGSAASS GLDFYDRLVD DLLDAGIAPV ATLYHWDTPA       120
     HVEEAGGWLA RDTAHRLADY AATAAARLAD RVAMWIPVNE PAIVTLLGYA TGQHAPGKAL       180
     LFDALPAAHH LNLGHGLAVQ ALRAAGATSV GTANNHTPAW AATGSAEDAA AASAYADLHN       240
     WLYADPVLAG RYPESLVDLL PVEDGDLATI AQPLDFYGVN YYNPTRLSAP SPGNPLPFDL       300
     VPITEHPVTG FGWPVVPAGL GEMIGALRTR HPNLPPVHVT ESGCSYPHSL DDTERVDYLA       360
     AHSEAAIAAG AKGYFVWSVL DNFEWDSGYS QRFGLVHVDY ATQRRTPRAS FRWYRDRIRR       420
//

If you have problems or comments...

PBIL Back to PBIL home page