(data stored in ACNUC7421 zone)

EMBL: CP001630.PE330

CP001630.PE330       Location/Qualifiers
FT   CDS             364370..366928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0335"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; AAA ATPase
FT                   central domain protein; UvrB/UvrC protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; KEGG: bha:BH0103 class
FT                   III stress response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34304"
FT                   /db_xref="GOA:C6WGI8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI8"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACU34304.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGIALEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVLQLLSGYSGGKEPAEAGGRGEGTPS
FT                   SSLVLDQFGRNLTSMAREGKLDPVIGRAKEIERVMQVLSRRTKNNPVLIGEPGVGKTAV
FT                   VEGLAQMVVKGEVPETLKDKQLYTLDLSSLVAGSRYRGDFEERLKKVLKEIRTRGDIIL
FT                   FIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYVEKDPALERRFQ
FT                   PIQVGEPSLEHTIEILKGLRDRYEAHHRVSITDSALVAAATLADRYINDRYLPDKAIDL
FT                   IDEAGARMRIRRMTAPPDLREFDEKIADVRRDKESAIDAQDFERAAKLRDQEKTLLGQK
FT                   AEREKQWKDGDLDVVAEVDEEQIAEVLANWTGIPVFKLTEEETTRLLRMEDELHKRIIG
FT                   QVEAVKAVSQAIRRTRAGLKDPKRPAGSFIFAGPSGVGKTELSKALANFLFGEDDALIQ
FT                   IDMGEFHDRYTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHNEVYNTL
FT                   LQVLEDGRLTDGQGRTVDFKNTVIIFTSNLGTSDISKAVGLGFASGQDNASNYERMKNK
FT                   VNDELKKHFRPEFLNRIDDIIVFHQLTRDEIIRMVDLLIARVETQLKNKDMAIELTEKA
FT                   KQLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGELQPGQIVITDVEGWDGESDQH
FT                   DKAKFVFRSEQKPTKVPDSPPVDLAGAGGDDSAQSEASGE"
     MFERFTDRAR RVVVLAQEEA RMLNHNYIGT EHILLGLIHE GEGVAAKALE SLGIALEGVR        60
     QQVEEIIGQG QQAPSGHIPF TPRAKKVLEL SLREALQLGH NYIGTEHILL GLIREGEGVA       120
     AQVLVKLGAD LNRVRQQVLQ LLSGYSGGKE PAEAGGRGEG TPSSSLVLDQ FGRNLTSMAR       180
     EGKLDPVIGR AKEIERVMQV LSRRTKNNPV LIGEPGVGKT AVVEGLAQMV VKGEVPETLK       240
     DKQLYTLDLS SLVAGSRYRG DFEERLKKVL KEIRTRGDII LFIDEIHTLV GAGAAEGAID       300
     AASILKPMLA RGELQTIGAT TLDEYRKYVE KDPALERRFQ PIQVGEPSLE HTIEILKGLR       360
     DRYEAHHRVS ITDSALVAAA TLADRYINDR YLPDKAIDLI DEAGARMRIR RMTAPPDLRE       420
     FDEKIADVRR DKESAIDAQD FERAAKLRDQ EKTLLGQKAE REKQWKDGDL DVVAEVDEEQ       480
     IAEVLANWTG IPVFKLTEEE TTRLLRMEDE LHKRIIGQVE AVKAVSQAIR RTRAGLKDPK       540
     RPAGSFIFAG PSGVGKTELS KALANFLFGE DDALIQIDMG EFHDRYTASR LFGAPPGYVG       600
     YEEGGQLTEK VRRKPFSVVL FDEIEKAHNE VYNTLLQVLE DGRLTDGQGR TVDFKNTVII       660
     FTSNLGTSDI SKAVGLGFAS GQDNASNYER MKNKVNDELK KHFRPEFLNR IDDIIVFHQL       720
     TRDEIIRMVD LLIARVETQL KNKDMAIELT EKAKQLLAKR GFDPVLGARP LRRTIQREIE       780
     DQLSEKILFG ELQPGQIVIT DVEGWDGESD QHDKAKFVFR SEQKPTKVPD SPPVDLAGAG       840
     GDDSAQSEAS GE                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page