(data stored in ACNUC7421 zone)

EMBL: CP001630.PE331

CP001630.PE331       Location/Qualifiers
FT   CDS             complement(367074..367718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0336"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="KEGG: saz:Sama_0018 pyroglutamyl-peptidase I;
FT                   TIGRFAM: pyrrolidone-carboxylate peptidase; PFAM: peptidase
FT                   C15 pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34305"
FT                   /db_xref="GOA:C6WGI9"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI9"
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /protein_id="ACU34305.1"
FT                   /translation="MDDPTVLITGFEPFGGERTNPSWDAVRELAERDPSLIAVELPCAF
FT                   DASARALREAVERHRPDLVVCVGQAGGRSGVTPERVAINLADARIPDNDGAQPIDVPVV
FT                   EGGPAAYFTGLPVKACVAALEEAGIPASVSHTAGTFVCNHVFYALMHLVATDFPDLRGG
FT                   FVHVPFAPEQVADREGVPSLEVSRTADALGLIVATCLSTTDDLAISTGTLS"
     MDDPTVLITG FEPFGGERTN PSWDAVRELA ERDPSLIAVE LPCAFDASAR ALREAVERHR        60
     PDLVVCVGQA GGRSGVTPER VAINLADARI PDNDGAQPID VPVVEGGPAA YFTGLPVKAC       120
     VAALEEAGIP ASVSHTAGTF VCNHVFYALM HLVATDFPDL RGGFVHVPFA PEQVADREGV       180
     PSLEVSRTAD ALGLIVATCL STTDDLAIST GTLS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page