(data stored in ACNUC7421 zone)

EMBL: CP001630.PE332

CP001630.PE332       Location/Qualifiers
FT   CDS             367737..368708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0337"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   afw:Anae109_1227 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34306"
FT                   /db_xref="GOA:C6WGJ0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ0"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACU34306.1"
FT                   /translation="MIEAPARRVGGRTATALVVLLAVGFLVPALTRLLGVDGNRYLAAT
FT                   TALTPLVTAAGVLVGALALLLRRWPVALVVLPVCLLLAASVTPRAIADDRPAGAGLPLR
FT                   VMASNFLVGKADAEAVVREVVERDVDVLAMQELSPAMVRDLENAGLDAVLPHRAFEDEP
FT                   GGSGSGIASRYPLTPARLVGPSSFRQASAVVELPNGKDVEVVSVHPMPPVEPQGPAQWR
FT                   RDLAALPPRNADGPIRVLAGDFNATLDHAPLRRLLDTGYADAADRVGAGLTPTWPNEGV
FT                   VPPLVALDHVLVDDRCPVDWFTAVDVPGSDHRAVVAQFVVPD"
     MIEAPARRVG GRTATALVVL LAVGFLVPAL TRLLGVDGNR YLAATTALTP LVTAAGVLVG        60
     ALALLLRRWP VALVVLPVCL LLAASVTPRA IADDRPAGAG LPLRVMASNF LVGKADAEAV       120
     VREVVERDVD VLAMQELSPA MVRDLENAGL DAVLPHRAFE DEPGGSGSGI ASRYPLTPAR       180
     LVGPSSFRQA SAVVELPNGK DVEVVSVHPM PPVEPQGPAQ WRRDLAALPP RNADGPIRVL       240
     AGDFNATLDH APLRRLLDTG YADAADRVGA GLTPTWPNEG VVPPLVALDH VLVDDRCPVD       300
     WFTAVDVPGS DHRAVVAQFV VPD                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page