(data stored in ACNUC7421 zone)

EMBL: CP001630.PE333

CP001630.PE333       Location/Qualifiers
FT   CDS             complement(368769..369539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0338"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: afw:Anae109_4302 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34307"
FT                   /db_xref="GOA:C6WGJ1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ1"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACU34307.1"
FT                   /translation="MVSGAGALLVCAGAGMGVDSGLPDFRGHAGFWRAYPPYERLGLGF
FT                   EEIADPVHFARDPEFAWGFYGHRLALYRATVPHAGFAVLRRLGARAFTSNVDGQFQLAG
FT                   FAGVAEVHGSIHHLQCQEPCSDDVWSADGVVVEVDPETMRAVSPLPTCPRCGGVARPNI
FT                   LMFGDSSWVGHRTGAQLAELAQWRREVGAGLVVLELGAGTAVPTVRRYAELSSAATGAL
FT                   VRVNPREADVRHGRGIAVPETALEFLDRLAGAAG"
     MVSGAGALLV CAGAGMGVDS GLPDFRGHAG FWRAYPPYER LGLGFEEIAD PVHFARDPEF        60
     AWGFYGHRLA LYRATVPHAG FAVLRRLGAR AFTSNVDGQF QLAGFAGVAE VHGSIHHLQC       120
     QEPCSDDVWS ADGVVVEVDP ETMRAVSPLP TCPRCGGVAR PNILMFGDSS WVGHRTGAQL       180
     AELAQWRREV GAGLVVLELG AGTAVPTVRR YAELSSAATG ALVRVNPREA DVRHGRGIAV       240
     PETALEFLDR LAGAAG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page