(data stored in ACNUC7421 zone)

EMBL: CP001630.PE334

CP001630.PE334       Location/Qualifiers
FT   CDS             complement(369553..369864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0339"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   afr:AFE_2662 antibiotic biosynthesis monooxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34308"
FT                   /db_xref="GOA:C6WGJ2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ2"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACU34308.1"
FT                   /translation="MAVVKINAIHVPEGSGPELEKRFEARLRAVDEEPGFLGFQLLRPV
FT                   AGDSRYFVVTHWADDESFDNWRKGRAEAAHAGERAKPVASGADLLEFEVVLESWPERG"
     MAVVKINAIH VPEGSGPELE KRFEARLRAV DEEPGFLGFQ LLRPVAGDSR YFVVTHWADD        60
     ESFDNWRKGR AEAAHAGERA KPVASGADLL EFEVVLESWP ERG                         103
//

If you have problems or comments...

PBIL Back to PBIL home page