(data stored in ACNUC7421 zone)

EMBL: CP001630.PE335

CP001630.PE335       Location/Qualifiers
FT   CDS             complement(369874..371352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0340"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: mxa:MXAN_0644 peptidase, M1 (aminopeptidase N)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34309"
FT                   /db_xref="GOA:C6WGJ3"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ3"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACU34309.1"
FT                   /translation="MAISPRARPYLLITAVALLVAGLLVVRLPDGSDTARETPEAPAPA
FT                   STPAVVGQRGGAGAGDPYYPEDGNTGYDVAGYDVSIGYDPATGHLDGVARVTARATADL
FT                   VSFNLDLRGLEVSSVEVGGEGAGFAREGEQELVITPAAPLASGSEFTAVVAYSGEPQSL
FT                   QDPVLGTNGWQRSQSGGAFAAGEPHSATTWYPANDTPRDKASFALSARVPDGWAAVSIG
FT                   LERGSTSEGGWTTFRWEHPEPVATYLTTVAVDRWEFERGALPDGTPVVNAYAPGAEAAR
FT                   AHGQELPSVLAFLADRFGPYPFDAAGGIYLSDRIGFSLETQTRPIYAAWADLETVVHEN
FT                   AHQWFGDAVTIRSWADICLNECFASYSTWLWAESLGADLDADYRAEVEKWRGSTGYWSR
FT                   KLYDMGRGNEFRGVYDKGQLAVHALRARIGDEAFDRALKTWISEHLDANASWPEFEAHV
FT                   QRVSGQDLSAFFQAWFRGDAIPADEHLWPGGLRG"
     MAISPRARPY LLITAVALLV AGLLVVRLPD GSDTARETPE APAPASTPAV VGQRGGAGAG        60
     DPYYPEDGNT GYDVAGYDVS IGYDPATGHL DGVARVTARA TADLVSFNLD LRGLEVSSVE       120
     VGGEGAGFAR EGEQELVITP AAPLASGSEF TAVVAYSGEP QSLQDPVLGT NGWQRSQSGG       180
     AFAAGEPHSA TTWYPANDTP RDKASFALSA RVPDGWAAVS IGLERGSTSE GGWTTFRWEH       240
     PEPVATYLTT VAVDRWEFER GALPDGTPVV NAYAPGAEAA RAHGQELPSV LAFLADRFGP       300
     YPFDAAGGIY LSDRIGFSLE TQTRPIYAAW ADLETVVHEN AHQWFGDAVT IRSWADICLN       360
     ECFASYSTWL WAESLGADLD ADYRAEVEKW RGSTGYWSRK LYDMGRGNEF RGVYDKGQLA       420
     VHALRARIGD EAFDRALKTW ISEHLDANAS WPEFEAHVQR VSGQDLSAFF QAWFRGDAIP       480
     ADEHLWPGGL RG                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page