(data stored in ACNUC7421 zone)

EMBL: CP001630.PE336

CP001630.PE336       Location/Qualifiers
FT   CDS             371370..372116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0341"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ppg:PputGB1_4047 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34310"
FT                   /db_xref="GOA:C6WGJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34310.1"
FT                   /translation="MSVIEFGGQGQGILLVHGLMSRATTWWKVARWLTAHGRVVAYDAR
FT                   GHGRNPQRGPFRTEDFVADAEALVERLGLGPCVVLGHSMGALHGLALAAARPDLVRAVV
FT                   AEDFVPDNRGRSVDDWRWYFDAWPVPFQSLAHVRSVVDVQGVEEMFEERGDGYHLIAQL
FT                   EDLYEIAAEWGERAYWDVVDAVACPVLVVEAGLHPLGPGQQAEVARRTGGAHLLVPESG
FT                   HVVHDEAPDVYRGAVEAFLSGLNPPV"
     MSVIEFGGQG QGILLVHGLM SRATTWWKVA RWLTAHGRVV AYDARGHGRN PQRGPFRTED        60
     FVADAEALVE RLGLGPCVVL GHSMGALHGL ALAAARPDLV RAVVAEDFVP DNRGRSVDDW       120
     RWYFDAWPVP FQSLAHVRSV VDVQGVEEMF EERGDGYHLI AQLEDLYEIA AEWGERAYWD       180
     VVDAVACPVL VVEAGLHPLG PGQQAEVARR TGGAHLLVPE SGHVVHDEAP DVYRGAVEAF       240
     LSGLNPPV                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page