(data stored in ACNUC7421 zone)

EMBL: CP001630.PE337

CP001630.PE337       Location/Qualifiers
FT   CDS             complement(372065..372571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34311"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34311.1"
FT                   /translation="MHALVVLFDEEADSAVRALWRGLGATSEFPPHVTWASATAIGPKV
FT                   RAELAADLEHLWLPDLWLRTLGTSAESEPSLDLTAVVDAELLAVHSAIHDVLAGRVRNP
FT                   TARHLPGSWTPRCTLLKGEPAEVSAAFAKVNPVPPIRARVRELSVLDTQTGGLSPLKKA
FT                   STAPR"
     MHALVVLFDE EADSAVRALW RGLGATSEFP PHVTWASATA IGPKVRAELA ADLEHLWLPD        60
     LWLRTLGTSA ESEPSLDLTA VVDAELLAVH SAIHDVLAGR VRNPTARHLP GSWTPRCTLL       120
     KGEPAEVSAA FAKVNPVPPI RARVRELSVL DTQTGGLSPL KKASTAPR                    168
//

If you have problems or comments...

PBIL Back to PBIL home page