(data stored in ACNUC7421 zone)

EMBL: CP001630.PE338

CP001630.PE338       Location/Qualifiers
FT   CDS             complement(372629..373618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0343"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; helix-hairpin-helix
FT                   motif; SMART: HhH-GPD family protein; KEGG: scl:sce3935
FT                   A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34312"
FT                   /db_xref="GOA:C6WGJ6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ6"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACU34312.1"
FT                   /translation="MSRTTSPTTSRATNRTASATTATAAAGAAEDAAKPESAHLPPSVL
FT                   NTWFAATARDLPWRDPECTAWGVLVSEIMLQQTPVARVEPIWRVWLDKWPRPSDMAAAS
FT                   QGEVLRMWGKLGYPRRALRLHAAAQAVAAEHDDVVPDDVETLLALPGIGAYTARAVAAF
FT                   AYGRRCPVVDTNVRRVVARAVHGAGDAGPPSTTRDLRDVEALLPEDEASAATYSAALME
FT                   LGALVCTARTPRCSACPVLGSCQWQRNGRPAYDGPAKAVQKFAGTDRQVRGRLLDVLRG
FT                   TSEPVAKEVLDRAWSDAGQRDRCLHSLLVDGLVEQTAAGLFALPGEHE"
     MSRTTSPTTS RATNRTASAT TATAAAGAAE DAAKPESAHL PPSVLNTWFA ATARDLPWRD        60
     PECTAWGVLV SEIMLQQTPV ARVEPIWRVW LDKWPRPSDM AAASQGEVLR MWGKLGYPRR       120
     ALRLHAAAQA VAAEHDDVVP DDVETLLALP GIGAYTARAV AAFAYGRRCP VVDTNVRRVV       180
     ARAVHGAGDA GPPSTTRDLR DVEALLPEDE ASAATYSAAL MELGALVCTA RTPRCSACPV       240
     LGSCQWQRNG RPAYDGPAKA VQKFAGTDRQ VRGRLLDVLR GTSEPVAKEV LDRAWSDAGQ       300
     RDRCLHSLLV DGLVEQTAAG LFALPGEHE                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page