(data stored in ACNUC7421 zone)

EMBL: CP001630.PE339

CP001630.PE339       Location/Qualifiers
FT   CDS             complement(373677..374168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0344"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: aba:Acid345_1601
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34313"
FT                   /db_xref="GOA:C6WGJ7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ7"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ACU34313.1"
FT                   /translation="MTAIDELLRRNEELGNIVPGDRSSPMPSMQVTILTCMDSRIRVFE
FT                   IFGLKQGEAHVLRNAGGVVTDDMIRSLALSQRKLGTREVLLVHHTNCGLELVTEDAFKD
FT                   ELETDSGMRPPWSVEAFREVKDSVRGSVNRVRNSPYLIHRDTVRGFVYDVRTGVLTEVV
FT                   "
     MTAIDELLRR NEELGNIVPG DRSSPMPSMQ VTILTCMDSR IRVFEIFGLK QGEAHVLRNA        60
     GGVVTDDMIR SLALSQRKLG TREVLLVHHT NCGLELVTED AFKDELETDS GMRPPWSVEA       120
     FREVKDSVRG SVNRVRNSPY LIHRDTVRGF VYDVRTGVLT EVV                         163
//

If you have problems or comments...

PBIL Back to PBIL home page