(data stored in ACNUC7421 zone)

EMBL: CP001630.PE34

CP001630.PE34        Location/Qualifiers
FT   CDS             37872..39179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0034"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ccs:CCNA_02400 transporter, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34008"
FT                   /db_xref="GOA:C6WCI7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34008.1"
FT                   /translation="MSALGPGAPDPAITGPAAPNPVVPDSAATAHDPLAEPVAPVGRGW
FT                   TTLLFLANLGLWLGVYAPIQVLLPQQAERISPDAKELVFGLVTALGAAVALIANPLIGL
FT                   SSDRTCSRFGRRHPWTLAGALVGALGLAVLSAADATWSMALGWCLVQAGLNGMLASLTS
FT                   GVPDRVPVAQRARVGGLVGISQMLGTVLGAVVVTVLVTGQTAGYLVCAALVVAGALAFV
FT                   LATPDTRLPRAARPPLVARELWVSPKRHPDFAWAWTAHFAINLGNALGTLYLLFFLADE
FT                   VRHPSPEDGLLVLMLLYGAALVVGAVLVGARSDRTGRRRGGVHLSAALMALAALLLAAW
FT                   PTWWSALIAAPLLGFGFGAYWAVALALLTQVLPAATDRAKDLGVVNVANALPQVLAPAL
FT                   ASVVLVDLGGYRGLFLLSAAATLVASLCVTRIRGVR"
     MSALGPGAPD PAITGPAAPN PVVPDSAATA HDPLAEPVAP VGRGWTTLLF LANLGLWLGV        60
     YAPIQVLLPQ QAERISPDAK ELVFGLVTAL GAAVALIANP LIGLSSDRTC SRFGRRHPWT       120
     LAGALVGALG LAVLSAADAT WSMALGWCLV QAGLNGMLAS LTSGVPDRVP VAQRARVGGL       180
     VGISQMLGTV LGAVVVTVLV TGQTAGYLVC AALVVAGALA FVLATPDTRL PRAARPPLVA       240
     RELWVSPKRH PDFAWAWTAH FAINLGNALG TLYLLFFLAD EVRHPSPEDG LLVLMLLYGA       300
     ALVVGAVLVG ARSDRTGRRR GGVHLSAALM ALAALLLAAW PTWWSALIAA PLLGFGFGAY       360
     WAVALALLTQ VLPAATDRAK DLGVVNVANA LPQVLAPALA SVVLVDLGGY RGLFLLSAAA       420
     TLVASLCVTR IRGVR                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page