(data stored in ACNUC7421 zone)

EMBL: CP001630.PE340

CP001630.PE340       Location/Qualifiers
FT   CDS             374248..375048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K05747 Wiskott-Aldrich
FT                   syndrome protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34314"
FT                   /db_xref="GOA:C6WGJ8"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34314.1"
FT                   /translation="MIHRIVRPPPSGVFAGRFASVGDVSWPHRPLPASVYWRRRVVAVG
FT                   GAALALVAAVWGTGAVLGRSAPQGAPVATTSTSNPPPLAEGLVLAEAGAASAGSTTGSP
FT                   APSADGPSAGAAEGTPPGSAGPPPPPEPPPGPPQPCDDAAVLVRAVLGKEQHAVGEHAD
FT                   FRIAVTNTGQLPCTREIGRGVRELVVTSPDGATRLWSSNDCLAAEGSEVRVMKPGEVFE
FT                   FGLKWPGTTSAPGCGPRTRLGAGDYLLVARVGDRSSDPAVFRIG"
     MIHRIVRPPP SGVFAGRFAS VGDVSWPHRP LPASVYWRRR VVAVGGAALA LVAAVWGTGA        60
     VLGRSAPQGA PVATTSTSNP PPLAEGLVLA EAGAASAGST TGSPAPSADG PSAGAAEGTP       120
     PGSAGPPPPP EPPPGPPQPC DDAAVLVRAV LGKEQHAVGE HADFRIAVTN TGQLPCTREI       180
     GRGVRELVVT SPDGATRLWS SNDCLAAEGS EVRVMKPGEV FEFGLKWPGT TSAPGCGPRT       240
     RLGAGDYLLV ARVGDRSSDP AVFRIG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page