(data stored in ACNUC7421 zone)

EMBL: CP001630.PE341

CP001630.PE341       Location/Qualifiers
FT   CDS             complement(375152..376255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0346"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: gox:GOX0577 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34315"
FT                   /db_xref="GOA:C6WGJ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACU34315.1"
FT                   /translation="MARSMHVRRPATLASLAAELGVSRTTVSNAYNRPDQLSPELRRRV
FT                   LETARRLGYPGPDPVARSLRTRKAGAVGLLLTENLSYAFRDPAAIGFLEGLALACETAG
FT                   QGLLLVPANPEREDVAAVHRAGVDGFVVYSVPDDDPHLAAVLERPVPTVVCDQPDLADV
FT                   DRVGIDDRAAMHQLAQHLIALGHRRVGVVCMRLARDRNDGFVPLSRQESAHFHVQRSRM
FT                   SGLRQAFTEVGVDWASVPVVERFDHTIAQGASAAAQVLDRDPQITALICTSDILALGAL
FT                   QEAERRGLRVPADLTVTGFDGIREAEQAGLTTVRQPVLEKGRAAGKLLMEIGERTKPRT
FT                   VTLETELITGTTAAEPRTIAEERWFGH"
     MARSMHVRRP ATLASLAAEL GVSRTTVSNA YNRPDQLSPE LRRRVLETAR RLGYPGPDPV        60
     ARSLRTRKAG AVGLLLTENL SYAFRDPAAI GFLEGLALAC ETAGQGLLLV PANPEREDVA       120
     AVHRAGVDGF VVYSVPDDDP HLAAVLERPV PTVVCDQPDL ADVDRVGIDD RAAMHQLAQH       180
     LIALGHRRVG VVCMRLARDR NDGFVPLSRQ ESAHFHVQRS RMSGLRQAFT EVGVDWASVP       240
     VVERFDHTIA QGASAAAQVL DRDPQITALI CTSDILALGA LQEAERRGLR VPADLTVTGF       300
     DGIREAEQAG LTTVRQPVLE KGRAAGKLLM EIGERTKPRT VTLETELITG TTAAEPRTIA       360
     EERWFGH                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page