(data stored in ACNUC7421 zone)

EMBL: CP001630.PE342

CP001630.PE342       Location/Qualifiers
FT   CDS             complement(376377..377420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0347"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pen:PSEEN1955 ribose operon repressor RbsR;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator; regulatory protein LacI; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34316"
FT                   /db_xref="GOA:C6WGK0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU34316.1"
FT                   /translation="MPGLAEIARAAGVSISTVSRVLNRRAGVNDETRQRVLAVLAEMPY
FT                   TPRGLGALQRTGVIGLLVPELSNPVFPAFAEALEVRAARLGYSSLLCNTRASGDAAMGE
FT                   EEYVRMLLARGVEGMVFVSPEITNAEAPLGRAARPSYYSRLLADGVHMVFVNGATPALD
FT                   VPDVTVDEQHAGYAATRHLVELGHRLIGFVSGPARALPSRLKRAGWAAALEEAGLGADG
FT                   SLVAHGPFGPEGGALAVAELLDSVRPTAVICSSDHMAIGVLREAHKRGLSVPGDLSVVG
FT                   FDDIPLAPYCSPPLTTLAQPIEEMATAAVDELVLRLDPDRRRRHSANYTRVFRPRLVVR
FT                   ESTASPE"
     MPGLAEIARA AGVSISTVSR VLNRRAGVND ETRQRVLAVL AEMPYTPRGL GALQRTGVIG        60
     LLVPELSNPV FPAFAEALEV RAARLGYSSL LCNTRASGDA AMGEEEYVRM LLARGVEGMV       120
     FVSPEITNAE APLGRAARPS YYSRLLADGV HMVFVNGATP ALDVPDVTVD EQHAGYAATR       180
     HLVELGHRLI GFVSGPARAL PSRLKRAGWA AALEEAGLGA DGSLVAHGPF GPEGGALAVA       240
     ELLDSVRPTA VICSSDHMAI GVLREAHKRG LSVPGDLSVV GFDDIPLAPY CSPPLTTLAQ       300
     PIEEMATAAV DELVLRLDPD RRRRHSANYT RVFRPRLVVR ESTASPE                     347
//

If you have problems or comments...

PBIL Back to PBIL home page