(data stored in ACNUC7421 zone)

EMBL: CP001630.PE343

CP001630.PE343       Location/Qualifiers
FT   CDS             377686..378945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0348"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34317"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34317.1"
FT                   /translation="MRRTTLLTALAAGLAPALALTACGGSSGGGGASGEVVFWDTSGPN
FT                   ESPVFTKVAQDCAAKDGYQVKTETVAFDAALNNYKTAAQGGQGPDVFRAEVAWVPQLAK
FT                   NGLVLDLTGTDLVKDTSDFLETPLGSTVYEGKTYGVPQVTDSLALFYNKKLLADAGVQP
FT                   PKTWDELKSVAAKLGGEKAFFVNNDAYYALPFLYGAGGDLVDAEAKEIVVSSPENVKGL
FT                   ETAKGLVDAKAATTALDAGNSYSNMQAGFGSGEIAMVVNGPWSVPDYLKGAAFADESNL
FT                   GIAPVPGVTEATAGLAPVGGHDYVVRQGAKAKDNALKLIACMSSAESQAKIATELGLLP
FT                   TRKSAYEVAEVKANAVVAAFEPVVAQAHPRPWIPEGGQLFDPLKTAYADFLAGKKDAKS
FT                   ALDEVAKTYKDQILPEYTVG"
     MRRTTLLTAL AAGLAPALAL TACGGSSGGG GASGEVVFWD TSGPNESPVF TKVAQDCAAK        60
     DGYQVKTETV AFDAALNNYK TAAQGGQGPD VFRAEVAWVP QLAKNGLVLD LTGTDLVKDT       120
     SDFLETPLGS TVYEGKTYGV PQVTDSLALF YNKKLLADAG VQPPKTWDEL KSVAAKLGGE       180
     KAFFVNNDAY YALPFLYGAG GDLVDAEAKE IVVSSPENVK GLETAKGLVD AKAATTALDA       240
     GNSYSNMQAG FGSGEIAMVV NGPWSVPDYL KGAAFADESN LGIAPVPGVT EATAGLAPVG       300
     GHDYVVRQGA KAKDNALKLI ACMSSAESQA KIATELGLLP TRKSAYEVAE VKANAVVAAF       360
     EPVVAQAHPR PWIPEGGQLF DPLKTAYADF LAGKKDAKSA LDEVAKTYKD QILPEYTVG        419
//

If you have problems or comments...

PBIL Back to PBIL home page