(data stored in ACNUC7421 zone)

EMBL: CP001630.PE344

CP001630.PE344       Location/Qualifiers
FT   CDS             379013..379930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0349"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_4135 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34318"
FT                   /db_xref="GOA:C6WGK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34318.1"
FT                   /translation="MRRFLDRHWYAYAMVLPVVLVIAVLVLYPLAQGVFFTLTDINESS
FT                   IANPVLDRPATYEWVGLRNYLTVLSGDASYGAFWATLLRTVVWTASCVLLHYGIGLGLA
FT                   VLLNRQVAGRAVYRVLLILPWAVPAFISAFAWKYMFNAQYGIINQVLRALGLPDPVWLG
FT                   QSNWALVAVVIVNVWLGVPFMMVSLLGGLQSIPADLYEAAEVDGATPWQRFRHVTLPGL
FT                   RSVSSTVVLLGVIWTFNMFAVVYLITGQNPSTRLLITYAFERFFSGASRDYAVASTYGV
FT                   LILSVLLVFASGYRRALRRQGEVW"
     MRRFLDRHWY AYAMVLPVVL VIAVLVLYPL AQGVFFTLTD INESSIANPV LDRPATYEWV        60
     GLRNYLTVLS GDASYGAFWA TLLRTVVWTA SCVLLHYGIG LGLAVLLNRQ VAGRAVYRVL       120
     LILPWAVPAF ISAFAWKYMF NAQYGIINQV LRALGLPDPV WLGQSNWALV AVVIVNVWLG       180
     VPFMMVSLLG GLQSIPADLY EAAEVDGATP WQRFRHVTLP GLRSVSSTVV LLGVIWTFNM       240
     FAVVYLITGQ NPSTRLLITY AFERFFSGAS RDYAVASTYG VLILSVLLVF ASGYRRALRR       300
     QGEVW                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page