(data stored in ACNUC7421 zone)

EMBL: CP001630.PE345

CP001630.PE345       Location/Qualifiers
FT   CDS             379930..380823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0350"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: acp:A2cp1_4287
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34319"
FT                   /db_xref="GOA:C6WGK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34319.1"
FT                   /translation="MSIEAASLRAATPARESRRAKRSRAASIGLHAALVTASLIAVFPV
FT                   FWVVVTSFKPDALAVETTPKLVNESSLDNYTRILSGEKGDFLAWFGNSVQIALLTTVLA
FT                   VFLSATAGYAASRFRFPGKRKLLLSFLVVQMFPFAVLIVPLYNTLLALGVQGTALGLVL
FT                   VYCTTAVPFCTYMLKGYFDTIPADIDEAGRVDGLSPFGVFWRLVLPLARPGLAVTSFYA
FT                   FLTAWGEVAFASAFLSAADESKTLAVGLQVFVQQNRTEWGHLAAASTLVAIPAVAVFYL
FT                   VQRFLVSGLAGGAVKG"
     MSIEAASLRA ATPARESRRA KRSRAASIGL HAALVTASLI AVFPVFWVVV TSFKPDALAV        60
     ETTPKLVNES SLDNYTRILS GEKGDFLAWF GNSVQIALLT TVLAVFLSAT AGYAASRFRF       120
     PGKRKLLLSF LVVQMFPFAV LIVPLYNTLL ALGVQGTALG LVLVYCTTAV PFCTYMLKGY       180
     FDTIPADIDE AGRVDGLSPF GVFWRLVLPL ARPGLAVTSF YAFLTAWGEV AFASAFLSAA       240
     DESKTLAVGL QVFVQQNRTE WGHLAAASTL VAIPAVAVFY LVQRFLVSGL AGGAVKG          297
//

If you have problems or comments...

PBIL Back to PBIL home page