(data stored in ACNUC7421 zone)

EMBL: CP001630.PE346

CP001630.PE346       Location/Qualifiers
FT   CDS             380907..382007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0351"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: rlt:Rleg2_5484
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34320"
FT                   /db_xref="GOA:C6WGK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34320.1"
FT                   /translation="MAEVAYDKASRIFSGNPPVRAVDELSLDVADGEFLVLVGPSGSGK
FT                   STALRMLAGLEDVDEGAIKIGGKDVTNVPPKGRDIAMVFQSYALYPHMTVAENMGFALK
FT                   LRKVAKEEIKQKVAEAAAMLDLTKYLDRKPKALSGGQRQRVAMGRAIVREPSVFLMDEP
FT                   LSNLDAKLRVETRANIAALQQRLGTTTIYVTHDQVEAMTMGHRVAVLKDGLLQQCDTPR
FT                   ALYDKPANAFVAGFMGSPAMNLKTVPLTAEGAKLDGLLVPLERTKLDAASGKGLSEVVF
FT                   GVRPESLALVGDGEPGMEMAVELVEELGADALLHGAVRIGDSSERFVVRVDGRTPPALG
FT                   QTVKVGVRDASEVHLFHPETGLRLTD"
     MAEVAYDKAS RIFSGNPPVR AVDELSLDVA DGEFLVLVGP SGSGKSTALR MLAGLEDVDE        60
     GAIKIGGKDV TNVPPKGRDI AMVFQSYALY PHMTVAENMG FALKLRKVAK EEIKQKVAEA       120
     AAMLDLTKYL DRKPKALSGG QRQRVAMGRA IVREPSVFLM DEPLSNLDAK LRVETRANIA       180
     ALQQRLGTTT IYVTHDQVEA MTMGHRVAVL KDGLLQQCDT PRALYDKPAN AFVAGFMGSP       240
     AMNLKTVPLT AEGAKLDGLL VPLERTKLDA ASGKGLSEVV FGVRPESLAL VGDGEPGMEM       300
     AVELVEELGA DALLHGAVRI GDSSERFVVR VDGRTPPALG QTVKVGVRDA SEVHLFHPET       360
     GLRLTD                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page