(data stored in ACNUC7421 zone)

EMBL: CP001630.PE347

CP001630.PE347       Location/Qualifiers
FT   CDS             382167..383057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0352"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   bpy:Bphyt_0292 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34321"
FT                   /db_xref="GOA:C6WGK5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK5"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACU34321.1"
FT                   /translation="MTVRTTLITAVAVLGLTTACGSADQGGSGSSDAPAGAVPVVTSTN
FT                   VWGSVVKAVGGDAVQVKALIDDPSADPHSFESKPADIAAVADAKLVVGNGGGYDDFFDK
FT                   IVDESARSAKRVDAFALSGKEENEHVWYDLATVRKVADKVAEELSAIAPDKKDAFTKGA
FT                   ADFGTALDGLTAKAERIKPAKVVVTEPVPAYLLETAGVEDLTPAEFTEAIENETDVPVA
FT                   AIAATGDLIVNKQVNALINNTQTENAVTGDLVAKAGTAGLPVVGMTETLPEGVTGYVEW
FT                   MTKQVDELTAALGTK"
     MTVRTTLITA VAVLGLTTAC GSADQGGSGS SDAPAGAVPV VTSTNVWGSV VKAVGGDAVQ        60
     VKALIDDPSA DPHSFESKPA DIAAVADAKL VVGNGGGYDD FFDKIVDESA RSAKRVDAFA       120
     LSGKEENEHV WYDLATVRKV ADKVAEELSA IAPDKKDAFT KGAADFGTAL DGLTAKAERI       180
     KPAKVVVTEP VPAYLLETAG VEDLTPAEFT EAIENETDVP VAAIAATGDL IVNKQVNALI       240
     NNTQTENAVT GDLVAKAGTA GLPVVGMTET LPEGVTGYVE WMTKQVDELT AALGTK           296
//

If you have problems or comments...

PBIL Back to PBIL home page