(data stored in ACNUC7421 zone)

EMBL: CP001630.PE348

CP001630.PE348       Location/Qualifiers
FT   CDS             383054..383896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bvi:Bcep1808_2715 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34322"
FT                   /db_xref="GOA:C6WGK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34322.1"
FT                   /translation="MSAQTTTPDRPAAQRGAVSLRSARLAYGDRVLWDGLDLDVRPGEF
FT                   IAVLGPNGSGKTSLMRVLLGLQPLSGGSVEIAGVPAGRGSRAIGYIPQQRPVDTSTVLR
FT                   GRDLVGLGLDGHRWGLGLRGRAERRRRVDEVLEAVGATAYADRPVGLLSGGEQQRLRVA
FT                   QALVGDPAVLLCDEPLLSLDLAHQRVVSDLINTRRRASDTAVLFVTHEINPVLPLVDRV
FT                   LYLVDGRFRIGSPAEVMTGETLSELYRTTVEVVRVRGQIHVVGAHGVCEDQPHHAEER"
     MSAQTTTPDR PAAQRGAVSL RSARLAYGDR VLWDGLDLDV RPGEFIAVLG PNGSGKTSLM        60
     RVLLGLQPLS GGSVEIAGVP AGRGSRAIGY IPQQRPVDTS TVLRGRDLVG LGLDGHRWGL       120
     GLRGRAERRR RVDEVLEAVG ATAYADRPVG LLSGGEQQRL RVAQALVGDP AVLLCDEPLL       180
     SLDLAHQRVV SDLINTRRRA SDTAVLFVTH EINPVLPLVD RVLYLVDGRF RIGSPAEVMT       240
     GETLSELYRT TVEVVRVRGQ IHVVGAHGVC EDQPHHAEER                             280
//

If you have problems or comments...

PBIL Back to PBIL home page