(data stored in ACNUC7421 zone)

EMBL: CP001630.PE349

CP001630.PE349       Location/Qualifiers
FT   CDS             383896..384732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0354"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: bxe:Bxe_A0715 ABC
FT                   Mn2+/Zn2+ transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34323"
FT                   /db_xref="GOA:C6WGK7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK7"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACU34323.1"
FT                   /translation="MESLFDFATTADLIGLPVVQRALLAAAVLGLVAGAIGPLVITRKM
FT                   SFAVHGTSELAFTGGAAALLLGISVSYGAVLGAVVAALLLGLLGQRDSERDSVIGAVLA
FT                   FGLGLGVLFLWLYPGRAANKMGLLVGQPIGIPAGDVQVLVVCAVVVLVVLALLYRPLLF
FT                   ASVDPDVALARGVPVRALSPVFAVLVGITTALGVQIVGALLVLSMMITPAAAAARITAS
FT                   PAKATVLAIVFAEVAVLGGIVLSLAPGVPVSAFVTAISFAIYVICRIVGKSRVRAV"
     MESLFDFATT ADLIGLPVVQ RALLAAAVLG LVAGAIGPLV ITRKMSFAVH GTSELAFTGG        60
     AAALLLGISV SYGAVLGAVV AALLLGLLGQ RDSERDSVIG AVLAFGLGLG VLFLWLYPGR       120
     AANKMGLLVG QPIGIPAGDV QVLVVCAVVV LVVLALLYRP LLFASVDPDV ALARGVPVRA       180
     LSPVFAVLVG ITTALGVQIV GALLVLSMMI TPAAAAARIT ASPAKATVLA IVFAEVAVLG       240
     GIVLSLAPGV PVSAFVTAIS FAIYVICRIV GKSRVRAV                               278
//

If you have problems or comments...

PBIL Back to PBIL home page