(data stored in ACNUC7421 zone)

EMBL: CP001630.PE35

CP001630.PE35        Location/Qualifiers
FT   CDS             39176..39943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0035"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34009"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34009.1"
FT                   /translation="MRVLVTGASQGIGAAVAERFAAQGAEVHLVARGAVALAAVVERIT
FT                   ARGGRAVAHVADLADERRVLALAEEVGPVDVLVNNAGVGRWLFLDDTAPDELRGMTALP
FT                   YASYALLTSLLLPAMRERGSGRLVFLNSPASRIAIPGATGYTAARWAVRGLVAALRQDL
FT                   RGTGVGVTEVVPGAVRSNYFDNNPGSAERIPWVVSRLVPTMTPERVAAEVVKAVARGRS
FT                   EVVFPWQIKLFDLVGRVIPGAVAYLAWRTGVHR"
     MRVLVTGASQ GIGAAVAERF AAQGAEVHLV ARGAVALAAV VERITARGGR AVAHVADLAD        60
     ERRVLALAEE VGPVDVLVNN AGVGRWLFLD DTAPDELRGM TALPYASYAL LTSLLLPAMR       120
     ERGSGRLVFL NSPASRIAIP GATGYTAARW AVRGLVAALR QDLRGTGVGV TEVVPGAVRS       180
     NYFDNNPGSA ERIPWVVSRL VPTMTPERVA AEVVKAVARG RSEVVFPWQI KLFDLVGRVI       240
     PGAVAYLAWR TGVHR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page