(data stored in ACNUC7421 zone)

EMBL: CP001630.PE350

CP001630.PE350       Location/Qualifiers
FT   CDS             complement(384876..386333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0355"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: cvi:CV_3252 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34324"
FT                   /db_xref="GOA:C6WGK8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACU34324.1"
FT                   /translation="MANSLPDHEPPTTPGVSAGRNWELWSLRPAAIAYILSLELVVLIS
FT                   TIWLMAGVGSASESDWFRFGAFAAAVTVHLTIVRRAEESRRDESASLYFDLTSVWTFAA
FT                   AVVLPAPLAVLIVLLLRVVTQPIARRQPYRFVFTSTHIVASTVLAGVAVREAGFPLLAT
FT                   GRVLGDLGLLAVLALTAALYWFTQVVLMTGVLKILNPRTRFADTLGSRGDNMLEATTLG
FT                   VGALLGLLTATHWAAPLLMVVPVVLANALLHRASERQAHLERLLAEQAQAHQQLTQDAH
FT                   TDFRTGLLNTTGLAEFAHRLAERGRIDGKPVTVLAIDLDHFKRINDTWGHPAGNAVLAE
FT                   VGRILREKLRPGDVAGRDGGEEFVVVLADTGLAEGTAIAERVREAIGLMVVVTTDKHRS
FT                   TVHLRGRDLPVNEDGQEVRAISASIGVAVLGEGPDALAHAQHSADAALYAAKERGRNQV
FT                   RVANVDIGGPRPAALARLQDHGVPRTA"
     MANSLPDHEP PTTPGVSAGR NWELWSLRPA AIAYILSLEL VVLISTIWLM AGVGSASESD        60
     WFRFGAFAAA VTVHLTIVRR AEESRRDESA SLYFDLTSVW TFAAAVVLPA PLAVLIVLLL       120
     RVVTQPIARR QPYRFVFTST HIVASTVLAG VAVREAGFPL LATGRVLGDL GLLAVLALTA       180
     ALYWFTQVVL MTGVLKILNP RTRFADTLGS RGDNMLEATT LGVGALLGLL TATHWAAPLL       240
     MVVPVVLANA LLHRASERQA HLERLLAEQA QAHQQLTQDA HTDFRTGLLN TTGLAEFAHR       300
     LAERGRIDGK PVTVLAIDLD HFKRINDTWG HPAGNAVLAE VGRILREKLR PGDVAGRDGG       360
     EEFVVVLADT GLAEGTAIAE RVREAIGLMV VVTTDKHRST VHLRGRDLPV NEDGQEVRAI       420
     SASIGVAVLG EGPDALAHAQ HSADAALYAA KERGRNQVRV ANVDIGGPRP AALARLQDHG       480
     VPRTA                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page