(data stored in ACNUC7421 zone)

EMBL: CP001630.PE351

CP001630.PE351       Location/Qualifiers
FT   CDS             complement(386565..387788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0356"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reh:H16_B2569 putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34325"
FT                   /db_xref="GOA:C6WGK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34325.1"
FT                   /translation="MTSGGALRALVGNREFRGLWIGSVVSTAGDQLAAVALSLLVFERT
FT                   GSPAWTAVTWASTLLPPLVSGPLLAWVADRHPRRTVMVTCAWLQAALVGAMALPGVPLW
FT                   GMVALLFSALMVASPFLAAQEASLPSVLPDERYDDGVALFGTSVDVAQMVGLAAAGFLV
FT                   TWAGPGAALALDAASFVLVAVLVQLSVEHRPAAAPRSAPEDPEGARSALALLLTEPRLR
FT                   SLLGMRLLAGLAMVPEGLAVPLADGLGAVWAVGLILAVEPAANVLGVALLFRFVRDPRQ
FT                   RERLMGPLAVLSLAPLALFALEPNLTWAIVLLVIAGMAGAYHTPARAAWMRLLPDAYRG
FT                   RAFGIARTALRTSQGGGMALAGVVAHAVGSVTATIAGAGGVGLLLAAQATVAWRRARAK
FT                   AGPDAVTT"
     MTSGGALRAL VGNREFRGLW IGSVVSTAGD QLAAVALSLL VFERTGSPAW TAVTWASTLL        60
     PPLVSGPLLA WVADRHPRRT VMVTCAWLQA ALVGAMALPG VPLWGMVALL FSALMVASPF       120
     LAAQEASLPS VLPDERYDDG VALFGTSVDV AQMVGLAAAG FLVTWAGPGA ALALDAASFV       180
     LVAVLVQLSV EHRPAAAPRS APEDPEGARS ALALLLTEPR LRSLLGMRLL AGLAMVPEGL       240
     AVPLADGLGA VWAVGLILAV EPAANVLGVA LLFRFVRDPR QRERLMGPLA VLSLAPLALF       300
     ALEPNLTWAI VLLVIAGMAG AYHTPARAAW MRLLPDAYRG RAFGIARTAL RTSQGGGMAL       360
     AGVVAHAVGS VTATIAGAGG VGLLLAAQAT VAWRRARAKA GPDAVTT                     407
//

If you have problems or comments...

PBIL Back to PBIL home page