(data stored in ACNUC7421 zone)

EMBL: CP001630.PE353

CP001630.PE353       Location/Qualifiers
FT   CDS             complement(388670..390100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0358"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: ppw:PputW619_0881 membrane bound O-acyl
FT                   transferase MBOAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34327"
FT                   /db_xref="GOA:C6WGL1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL1"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /protein_id="ACU34327.1"
FT                   /translation="MSFATPLFLWFFVPAVLTAVLVAPRGWRNGIVAVASLLFYVTGAG
FT                   GTTLLLLACMVVNYLAGLRLAPDGPLAADKRRVLLVGVIGFDLAVLLVWKYLGFATEQL
FT                   AAIASIVGADLPVVHLALPIGISFYTFHHISYVVDVYRGERPALREPVSFITYIAMFPQ
FT                   LVAGPIVRWREIADQLPQERTHRLDDIAAGFPRFALGLCKKVIVADSLAPLVDAAFATP
FT                   SDEMTWSVAWLGAIGYALQLYFDFSGYSDMAIGLGRMLGFRLPENFARPYSSVTITEFW
FT                   RRWHMSLSRWFRDYLYIPLGGNRRGTWTTYRNLSIVFVLTGFWHGANWTFLVWGVFHGA
FT                   LLIVERRFGWAEAPQGPKALLGRRALTFLLVVVGWVFFRSPDLGTAFSVLGNMLVPDFD
FT                   GLPDAVAVAATNQRIALLVLALVVVLLPNHPVTGPYLESARTRVATGLRVAVMTVGALY
FT                   AAILVAGGTFSPFLYYQF"
     MSFATPLFLW FFVPAVLTAV LVAPRGWRNG IVAVASLLFY VTGAGGTTLL LLACMVVNYL        60
     AGLRLAPDGP LAADKRRVLL VGVIGFDLAV LLVWKYLGFA TEQLAAIASI VGADLPVVHL       120
     ALPIGISFYT FHHISYVVDV YRGERPALRE PVSFITYIAM FPQLVAGPIV RWREIADQLP       180
     QERTHRLDDI AAGFPRFALG LCKKVIVADS LAPLVDAAFA TPSDEMTWSV AWLGAIGYAL       240
     QLYFDFSGYS DMAIGLGRML GFRLPENFAR PYSSVTITEF WRRWHMSLSR WFRDYLYIPL       300
     GGNRRGTWTT YRNLSIVFVL TGFWHGANWT FLVWGVFHGA LLIVERRFGW AEAPQGPKAL       360
     LGRRALTFLL VVVGWVFFRS PDLGTAFSVL GNMLVPDFDG LPDAVAVAAT NQRIALLVLA       420
     LVVVLLPNHP VTGPYLESAR TRVATGLRVA VMTVGALYAA ILVAGGTFSP FLYYQF           476
//

If you have problems or comments...

PBIL Back to PBIL home page