(data stored in ACNUC7421 zone)

EMBL: CP001630.PE354

CP001630.PE354       Location/Qualifiers
FT   CDS             complement(390193..391158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0359"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: afw:Anae109_2230
FT                   RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34328"
FT                   /db_xref="GOA:C6WGL2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL2"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACU34328.1"
FT                   /translation="MAGNSKRRGAMRTPGSKKGAVVGSGGQKSKGLQGKGPTPKAQDRP
FT                   NHPAYRKANAAAKANAVRQQRRKAADAAPETVAGRNPVVECLRAGIPATALYVALGIDA
FT                   DDRVAEAVQLAASRGISVLEVQRGELDRITGGAMHQGLGLQVPPYEYAEPRDLLRAAKE
FT                   SGRPPLLVALDGVTDPRNLGAVVRSAAAFGAHGVVLPQRRSASMTAVAWRTSAGTAARL
FT                   PIAVATNLTRQLREWAEAGLMVIGLDADGDVDVDGLDLATGPLVVVVGSEGRGLSRLVR
FT                   ETCDQTVSIPMASNVESLNASVAAGVVLAEVARRRRLDAR"
     MAGNSKRRGA MRTPGSKKGA VVGSGGQKSK GLQGKGPTPK AQDRPNHPAY RKANAAAKAN        60
     AVRQQRRKAA DAAPETVAGR NPVVECLRAG IPATALYVAL GIDADDRVAE AVQLAASRGI       120
     SVLEVQRGEL DRITGGAMHQ GLGLQVPPYE YAEPRDLLRA AKESGRPPLL VALDGVTDPR       180
     NLGAVVRSAA AFGAHGVVLP QRRSASMTAV AWRTSAGTAA RLPIAVATNL TRQLREWAEA       240
     GLMVIGLDAD GDVDVDGLDL ATGPLVVVVG SEGRGLSRLV RETCDQTVSI PMASNVESLN       300
     ASVAAGVVLA EVARRRRLDA R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page