(data stored in ACNUC7421 zone)

EMBL: CP001630.PE355

CP001630.PE355       Location/Qualifiers
FT   CDS             complement(391164..392558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0360"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: aeh:Mlg_1810 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34329"
FT                   /db_xref="GOA:C6WGL3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL3"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACU34329.1"
FT                   /translation="MSLHIYDTASRELREFRPQISGTASIYVCGATVQGVPHIGHVRSG
FT                   LNFDVLRRWLARTHERVVLVRNVTDIDDKILVKSAQHDRTWWDWAFEHERAFDDAYEAL
FT                   GCLPPTYAPRATGHVTQMVELMRRLIDAGHAYAANGDVYFSVSSFPEYGKLSGQRVDEV
FT                   QQGESELTGKRDPRDFTLWKAAKPGEPSWPTPWGDGRPGWHLECSAMATEYLGSTFDVH
FT                   GGGIDLIFPHHENEQAQSRAVGDGFARYWMHNAWVTLSGEKMSKSLGNTVSIPAMLEQV
FT                   RAPELRYYLVGPHYRSTIEYSPTALDEAVTAYRRIESFLRRVVERTGAVDAGGELGEDF
FT                   VSSMDDDMGTPGALAAVHKRVREGNTALESGDDTGARAAASSVRAMTAVLGLDPLSERW
FT                   SASAGRESGTSRALKALVDRVLADRVAARKERDFARADALRDSLLAAGIAVEDTPDGPL
FT                   WTLKDS"
     MSLHIYDTAS RELREFRPQI SGTASIYVCG ATVQGVPHIG HVRSGLNFDV LRRWLARTHE        60
     RVVLVRNVTD IDDKILVKSA QHDRTWWDWA FEHERAFDDA YEALGCLPPT YAPRATGHVT       120
     QMVELMRRLI DAGHAYAANG DVYFSVSSFP EYGKLSGQRV DEVQQGESEL TGKRDPRDFT       180
     LWKAAKPGEP SWPTPWGDGR PGWHLECSAM ATEYLGSTFD VHGGGIDLIF PHHENEQAQS       240
     RAVGDGFARY WMHNAWVTLS GEKMSKSLGN TVSIPAMLEQ VRAPELRYYL VGPHYRSTIE       300
     YSPTALDEAV TAYRRIESFL RRVVERTGAV DAGGELGEDF VSSMDDDMGT PGALAAVHKR       360
     VREGNTALES GDDTGARAAA SSVRAMTAVL GLDPLSERWS ASAGRESGTS RALKALVDRV       420
     LADRVAARKE RDFARADALR DSLLAAGIAV EDTPDGPLWT LKDS                        464
//

If you have problems or comments...

PBIL Back to PBIL home page