(data stored in ACNUC7421 zone)

EMBL: CP001630.PE356

CP001630.PE356       Location/Qualifiers
FT   CDS             complement(392625..393236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0361"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2 (HAD-like)"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 2 (HAD-like); HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: haloacid dehalogenase-like hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34330"
FT                   /db_xref="GOA:C6WGL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL4"
FT                   /inference="protein motif:TFAM:TIGR01493"
FT                   /protein_id="ACU34330.1"
FT                   /translation="MTIRAVLFDFSNTLFRLEHPSFALHGELMRALTAPFGLPDGFAVD
FT                   ADTWERRDLDPVAHREAHVEVLASAGAEDPDGFYESLLSPTRWQAYPDTAVALGTHLRT
FT                   AVVSNIGWDVRAVFARHGVLGRVDEFVLSYEEGVVKPDPKLFEVACERLGVEPGEALMI
FT                   GDSEEADGGARAVGCRFELVEPLPTQERPDALLDAISRHA"
     MTIRAVLFDF SNTLFRLEHP SFALHGELMR ALTAPFGLPD GFAVDADTWE RRDLDPVAHR        60
     EAHVEVLASA GAEDPDGFYE SLLSPTRWQA YPDTAVALGT HLRTAVVSNI GWDVRAVFAR       120
     HGVLGRVDEF VLSYEEGVVK PDPKLFEVAC ERLGVEPGEA LMIGDSEEAD GGARAVGCRF       180
     ELVEPLPTQE RPDALLDAIS RHA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page