(data stored in ACNUC7421 zone)

EMBL: CP001630.PE357

CP001630.PE357       Location/Qualifiers
FT   CDS             complement(393471..393938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0362"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: eli:ELI_06290 bifunctional 2-C-methyl-D-
FT                   erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-
FT                   erythritol 2,4-cyclodiphosphate synthase protein; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34331"
FT                   /db_xref="GOA:C6WGL5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL5"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACU34331.1"
FT                   /translation="MRVGIGTDVHPVEPGRDCWMVGLLWEGADGCAGHSDGDVAAHALC
FT                   DALLSAAGLGDLGAVFGTSDPRWSGAHGVEFLAEARRLVEAEGFVVGNAAVQVIGNAPR
FT                   VGKRRAEAQKVLSEVLGGPVSVSGTTTDGLGLTGRGEGVAAVATALLLPKG"
     MRVGIGTDVH PVEPGRDCWM VGLLWEGADG CAGHSDGDVA AHALCDALLS AAGLGDLGAV        60
     FGTSDPRWSG AHGVEFLAEA RRLVEAEGFV VGNAAVQVIG NAPRVGKRRA EAQKVLSEVL       120
     GGPVSVSGTT TDGLGLTGRG EGVAAVATAL LLPKG                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page