(data stored in ACNUC7421 zone)

EMBL: CP001630.PE358

CP001630.PE358       Location/Qualifiers
FT   CDS             complement(393935..394627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0363"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   bcr:BCAH187_A0116 2-C-methyl-D-erythritol 4- phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34332"
FT                   /db_xref="GOA:C6WGL6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL6"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACU34332.1"
FT                   /translation="MGVVALVPAAGRGERLGFGMPKALVPVGGVPLLVRAIRGLFESGR
FT                   VRHVVVAAPPSDVDQVRTVTAPLAPAGGAVHVLAGGAERSDSVRLALEHALAEVPDVRV
FT                   VLVHDAARAFTPPTVVRDVVDAVLAGHPAVIPVLPVADTVKRVDTKGVVVDTPDRSLLR
FT                   VVQTPQGFDAATLRAAHESGLHATDDAGLVERLGVPVVTVTGHQDAMKVTTPFDLAVAE
FT                   ALLVGGTG"
     MGVVALVPAA GRGERLGFGM PKALVPVGGV PLLVRAIRGL FESGRVRHVV VAAPPSDVDQ        60
     VRTVTAPLAP AGGAVHVLAG GAERSDSVRL ALEHALAEVP DVRVVLVHDA ARAFTPPTVV       120
     RDVVDAVLAG HPAVIPVLPV ADTVKRVDTK GVVVDTPDRS LLRVVQTPQG FDAATLRAAH       180
     ESGLHATDDA GLVERLGVPV VTVTGHQDAM KVTTPFDLAV AEALLVGGTG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page