(data stored in ACNUC7421 zone)

EMBL: CP001630.PE359

CP001630.PE359       Location/Qualifiers
FT   CDS             complement(394663..395151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0364"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG:
FT                   bcb:BCB4264_A4827 transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34333"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL7"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACU34333.1"
FT                   /translation="MVFKVGETVVYPHHGAALIEAIETRVIKGEEKKYLVLKVAQGDLT
FT                   VRVPADNAEIVGVRDVVGQEGLDKVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREKDRGLSAGEKRMLAKARQILVSELALAEGTDEDKAEVLLDEVLATAS"
     MVFKVGETVV YPHHGAALIE AIETRVIKGE EKKYLVLKVA QGDLTVRVPA DNAEIVGVRD        60
     VVGQEGLDKV FEVLRAPHTE EPTNWSRRYK ANLEKLASGD VNKVAEVVRD LWRREKDRGL       120
     SAGEKRMLAK ARQILVSELA LAEGTDEDKA EVLLDEVLAT AS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page